0170 - 381 7441 mail@paddel-grafik.de

{ "event" : "MessagesWidgetMessageEdit", Wählt Netzwerk- und Freigabecenter öffnen aus. "truncateBody" : "true", }, }, if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { "useTruncatedSubject" : "true", } Weiter Letzte. "messageViewOptions" : "1111110111111111111110111110100101001101" { { $(this).removeClass('active'); "actions" : [ }, ] "action" : "rerender" } "eventActions" : [ "actions" : [ "actions" : [ } "action" : "rerender" { "disableLabelLinks" : "false", } "actions" : [ "event" : "MessagesWidgetCommentForm", }, } "parameters" : { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_2db6002ee70b48","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_2db6002ee70b48_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/258636&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"JtobB3fJR6-m9M5vgXpdmsej61Si-mFr_V8WWCSVxlo. "actions" : [ "context" : "", "showCountOnly" : "false", "context" : "", Windows 10: DNS Server ändern für schnellere Verbindungen In dieser Anleitung werde ich zeigen, wie man die DNS-Server auf einem Windows 10 Computer ändert. }, $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_2db6002ee70b48","tooltipContentSelector":"#link_2db6002ee70b48_0-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_2db6002ee70b48_0-tooltip-element","events":{"def":"focus mouseover,blur mouseout"},"hideOnLeave":true}); "context" : "envParam:entity", "action" : "rerender" "context" : "", } }, "context" : "envParam:selectedMessage", { "event" : "addMessageUserEmailSubscription", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2188829 .lia-rating-control-passive', '#form_1'); "context" : "", $('#community-menu-toggle').click(function() { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); // Reset the conditions so that someone can do it all again. "event" : "ProductAnswer", "event" : "MessagesWidgetAnswerForm", }, }, }, { LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); }, }, } "actions" : [ "context" : "envParam:feedbackData", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "showCountOnly" : "false", { } else { ] "triggerEvent" : "click", }, "initiatorDataMatcher" : "data-lia-kudos-id" }, "action" : "rerender" "context" : "", { element.siblings('li').removeClass('active'); // Oops, not the right sequence, lets restart from the top. "action" : "rerender" }); "; '; "disableLabelLinks" : "false", }, "action" : "rerender" if (typeof(Storage) !== "undefined") { }, "selector" : "#messageview_0", ] // enable redirect to login page when "logmein" is typed into the void =) .attr('aria-selected','false'); "disableLabelLinks" : "false", $('.css-menu').removeClass('cssmenu-open') LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); "actions" : [ }, { }, { "triggerEvent" : "click", } ] { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox","feedbackSelector":".InfoMessage"}); { { "context" : "", } "selector" : "#messageview_1", }, } { DNS-Server ändern: Windows. "kudosLinksDisabled" : "false", var resetMenu = function() { "initiatorDataMatcher" : "data-lia-kudos-id" }, $(this).toggleClass("view-btn-open view-btn-close"); "actions" : [ LITHIUM.Dialog({ ] { LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ "truncateBody" : "true", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2188829,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "", LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'q2Q33SSOezmisDpzcBjMnmWYbtFkW6DxoHuOD0LPL74. ;(function($) { //$('#vodafone-community-header').css('display','block'); "event" : "ProductAnswerComment", "context" : "", }, "action" : "rerender" element.addClass('active'); var clickHandler = function(event) { "actions" : [ } "event" : "MessagesWidgetEditAnswerForm", $(this).removeClass('active'); LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); $('#vodafone-community-header .lia-search-toggle').click(function() { var element = $(this).parent('li'); lithadmin: [] }, var watching = false; "linkDisabled" : "false" })(LITHIUM.jQuery); "actions" : [ Server: Servername / IP-Adresse: DNS-Server 1 DNS-Server 2: 195.50.140.114 195.50.140.252:. { }, ] ', 'ajax'); }, { //$('#lia-body').addClass('lia-window-scroll'); "context" : "", "event" : "AcceptSolutionAction", { } } "action" : "rerender" "event" : "removeMessageUserEmailSubscription", "event" : "QuickReply", } \\n\\t\\t\\t\\n\\t\\n\\n\\t\\n\\n\\t\\t\";LITHIUM.AjaxSupport.defaultAjaxErrorHtml = \", \\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\t\\t, '; "event" : "markAsSpamWithoutRedirect", { window.scrollTo(0,position_x.top - 150); "event" : "MessagesWidgetEditCommentForm", "event" : "addMessageUserEmailSubscription", } "event" : "addMessageUserEmailSubscription", "eventActions" : [ { "context" : "", count = 0; $(document).ready(function(){ "context" : "", } "action" : "rerender" //if(height > 430) { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "markAsSpamWithoutRedirect", { }); "disallowZeroCount" : "false", } }, }, "action" : "rerender" //$('#community-menu-toggle').removeClass('active') LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); "event" : "RevokeSolutionAction", } Bist du sicher, dass du fortfahren möchtest? ] Dort kannst du die IP-Adresse eines eigenen DNS-Server eintragen. { { "actions" : [ { "componentId" : "forums.widget.message-view", }, "actions" : [ $('.js-close-header-announcement').on('click', clickHandler); ;(function($) { "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); // We made it! "displaySubject" : "true", "actions" : [ }, "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName,expandedQuiltName", LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "selector" : "#kudosButtonV2_1", }, { } "activecastFullscreen" : false, Um sie zu nutzen, ändern Sie die DNS-Einstellungen in Windows. ] } window.location = "https://forum.vodafone.de/t5/St%C3%B6rungsmeldungen-Internet-TV/DNS-Server-%C3%A4ndern/td-p/2188815" + "/page/" + 1; "truncateBodyRetainsHtml" : "false", "action" : "rerender" { "action" : "rerender" "action" : "rerender" LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "revokeMode" : "true", })(LITHIUM.jQuery); { "context" : "envParam:quiltName", { { { "context" : "", }, }, }, } // If watching, pay attention to key presses, looking for right sequence. $('#vodafone-community-header').toggle(); ] ] "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "action" : "rerender" "context" : "", "context" : "", { { Dies funktioniert auch bei der 6490 Providerbox von Vodafone/KD. .attr('aria-expanded','true'); $(document).ready(function(){ Hier wird ihnen gezeigt wie sie ganz einfach die Internetsperren z.B: einer Schule, mittels Änderung des DNS-Servers, umgehen können. LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ "useCountToKudo" : "false", ] }else{ }, "useSubjectIcons" : "true", // console.log(key); { { }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "ProductMessageEdit", "event" : "addThreadUserEmailSubscription", // enable redirect to login page when "logmein" is typed into the void =) { "event" : "removeThreadUserEmailSubscription", //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); Hier gibt es die Info wie Ihr eure IPv4 und IPv6 ändert. }, }, "action" : "rerender" "useTruncatedSubject" : "true", { "actions" : [ { "action" : "addClassName" ] LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; var notifCount = 0; }, "actions" : [ var count = 0; ;(function($) { $('.lia-button-wrapper-searchForm-action').removeClass('active'); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" { // Reset the conditions so that someone can do it all again. }); LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); }, ] "action" : "rerender" "event" : "removeThreadUserEmailSubscription", // Set start to true only if the first key in the sequence is pressed { { }, "}); ] ] "actions" : [ { "event" : "MessagesWidgetCommentForm", "context" : "envParam:selectedMessage", "disableLabelLinks" : "false", { "truncateBodyRetainsHtml" : "false", LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ }, { } "event" : "unapproveMessage", }); var keycodes = { "event" : "MessagesWidgetAnswerForm", { "action" : "rerender" "event" : "deleteMessage", "event" : "RevokeSolutionAction", "truncateBodyRetainsHtml" : "false", ctaHTML += "Lösung noch nicht gefunden? ] LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_2db6002ee70b48","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/258636&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); ] "context" : "envParam:selectedMessage", "action" : "rerender" { LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_2db6002fef59f9', 'disableAutoComplete', '#ajaxfeedback_2db6002ee70b48_0', 'LITHIUM:ajaxError', {}, 'HlvPcjVqwIrKqjBvMZ0UtOpqc0WTAhqkI-ZO5us8qxY. "context" : "envParam:quiltName", "event" : "editProductMessage", ] "parameters" : { } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "linkDisabled" : "false" } "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "event" : "MessagesWidgetEditAnswerForm", "actions" : [ "closeEvent" : "LITHIUM:lightboxCloseEvent", { } count++; { } ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); avm.de in 212.42.244.80). LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_2db6002ee70b48', 'enableAutoComplete', '#ajaxfeedback_2db6002ee70b48_0', 'LITHIUM:ajaxError', {}, 'lN2D3QyuBNQ4HWdOx3yg-sTnNuqkYy12WFj8nJ-YdvU. ;(function($) { ', 'ajax'); }, }, "action" : "rerender" $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ } "action" : "rerender" } "event" : "AcceptSolutionAction", }, "; return; "context" : "envParam:quiltName", Ersteller des Themas Domingo2010; Erstellungsdatum 6. LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.Dialog({ "componentId" : "kudos.widget.button", "action" : "rerender" { }); } } "action" : "rerender" }, ] { LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }); "event" : "addMessageUserEmailSubscription", "initiatorDataMatcher" : "data-lia-message-uid" { ] } { return; }); $(this).toggleClass('active'); { "context" : "", { } "actions" : [ }, } } } "context" : "", { if ( watching ) { "actions" : [ "actions" : [ { { } "event" : "ProductMessageEdit", ] "disableKudosForAnonUser" : "false", "action" : "rerender" Selbst das mit der VPN funktioniert bei mir nicht, Ja Ich probiere es mal aus mit der Neuinstallation aber bin mir sicher das es nichts bringen wird mal schauen. ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); var watching = false; "context" : "envParam:quiltName,message,product,contextId,contextUrl", } // --> $('.css-menu').removeClass('cssmenu-open') var clickedDomElement = $(this); "includeRepliesModerationState" : "false", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", } Das Gerät zeigt folgende Infos an (hat der Router keinen Namne?) "event" : "ProductAnswer", } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "context" : "", Es geht immer noch nicht, hab Pc neugestartet etc. lithstudio: [], }, "event" : "unapproveMessage", return; "actions" : [ event.stopPropagation(); "actions" : [ "event" : "editProductMessage", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); { ], //$(window).scroll(function() { ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_2db6002ee70b48_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/258636&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); täglich ab 13:00 Uhr sehr geringe Downloadgeschwin... Vodafone Station cga4233de Internet-LED blinkt rot. { { watching = true; //resetMenu(); ', 'ajax'); { "action" : "rerender" ] } count++; return; "dialogContentCssClass" : "lia-panel-dialog-content", "action" : "rerender" $('.js-close-header-announcement').on('click', clickHandler); }, }); }); "action" : "rerender" } "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", window.location.replace('/t5/user/userloginpage'); LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2188829 .lia-rating-control-passive', '#form_1'); window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":711,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBFcKBlVQAFQNBhgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVcBVcNVlMOVxQHWgMHSQFSBQNID1ELUE8AB1QDBgdQUlRQDQFAThUPVn1bVgB\/AhsIQDFDC0dGWlUWWwNVVhcMUAFbelpGAEQIXEY2NGMBWVZSXQsUShtZATBSF0FlBmMQUxRAEFhAZCF5dndmRV8CGXQwLXpEWFZHQQRRA0oSNSpyNnATQF0VXwUXWwZfCER5enl7MRZZG08f"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "message" : "2188829", var handleOpen = function(event) { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/258636","ajaxErrorEventName":"LITHIUM:ajaxError","token":"_mchk7T8ey3TdNt9UXQ9dyn9lcmSL6NqfhnLSc_hVUs. "message" : "2188829", { LITHIUM.AjaxSupport.ComponentEvents.set({ So einfach kann man also die DNS Server ändern, den ab sofort nutzt man nicht mehr die Domain Name Server des Providers, sondern die, meistens schnelleren von … $(document).keydown(function(e) { }, "context" : "envParam:quiltName", "action" : "rerender" ] "action" : "rerender" { "event" : "editProductMessage", "displayStyle" : "horizontal", ], } } "actions" : [ }, } { ] LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport.ComponentEvents.set({ { { //var height = $(window).scrollTop(); { } "event" : "AcceptSolutionAction", ] ] "context" : "envParam:quiltName,expandedQuiltName", Danach versucht Ihr einfach mal das Setup von StateV zu installieren bzw.

Barcelona Göttingen Karte, Hotel Alpenruhe Oberstdorf, Familienhotel Immenstadt Allgäu, Ziegelhof Steinwand Speisekarte, Peter Singer Abtreibung,